Bureau national du Parti socialiste du lundi 7 mars Intervention de Gérard Filoche

Personne n’avait demandé cette loi. Aucun syndicat, aucune force sociale n’était demandeuse. Personne n’en avait exprimé le besoin, puisque que chacun sait que cela n’a pas de rapport avec l’emploi. Sauf Pierre Gattaz pour le Medef, qui a déclaré en août 2015 « le code du travail est l’ennemi n°1 des patrons ».

Return-Path: <gerard.filoche@gmail.com>

Received: from mwinf5c59 (mwinf5c59.me-wanadoo.net [10.223.111.109])
by mwinb2p04 with LMTPA;
Tue, 08 Mar 2016 07:44:31 +0100

X-Sieve: CMU Sieve 2.3

Received: from mail-wm0-f43.google.com ([74.125.82.43])
by mwinf5c59 with ME
id THzw1s00P0w4wBu01JkWgf; Tue, 08 Mar 2016 07:44:31 +0100

X-bcc: jean.medan@orange.fr

X-ME-bounce-domain: orange.fr

X-ME-engine: default

X-me-spamcause: (0)(0000)gggruggvucftvghtrhhoucdtuddrfeekjedrkedvgdeliecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfogfdpggftiffpkfenuceurghilhhou
hhtmecugedttdenucenucfjughrpefhtgffuffvkfggofesrgdtmherhhdtjeenucfhrhhomhepiforrhgrrhgupgfhihhlohgthhgvuceoghgvrhgrrhgurdhfihhlohg
thhgvsehgmhgrihhlrdgtohhmqeenucfkphepjeegrdduvdehrdekvddrgeefpdeltddrgeeirddukeelrddvfeeknecurfgrrhgrmhephhgvlhhopehmrghilhdqfihmt
ddqfhegfedrghhoohhglhgvrdgtohhmpdhinhgvthepjeegrdduvdehrdekvddrgeefpdhmrghilhhfrhhomhepghgvrhgrrhgurdhfihhlohgthhgvsehgmhgrihhlrdg
tohhmpdhrtghpthhtohepfhhrrghntghkuddrrhgvhiesohhrrghnghgvrdhfrh

X-me-spamlevel: not-spam

X-ME-Helo: mail-wm0-f43.google.com

X-ME-IP: 74.125.82.43

X-ME-Entity: ofr

Received: by mail-wm0-f43.google.com with SMTP id p65so13140956wmp.0;
       Mon, 07 Mar 2016 22:44:30 -0800 (PST)

DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
       d=gmail.com; s=20120113;
       h=from:date:subject:to:message-id:mime-version;
       bh=MVJscsuoe7AdH+iVT/lVQ0uZgnjibw28JNl85/38V9w=;
       b=gNcY5gTBbLs3op9P9jdaTGiqORU5+YTeJxShaFcAGzJS/NhwhpXu7sKpDSDpEOrmqa
        +6rgVvKCM8tFyGT8p1vlUkPczgs804uSLwkNrVdo6x6o6Gh+EQAkXgrNGq1IFssOPZv4
        pA0ha9mXzML6otODlckUBYZH078a58Y7VR5WK6MG03m0YmxQ6JdYzmv3vR52XkKOeRB0
        hmqWmwC4ZwV8sDWgsLutIx8LDV276tGbEUbdvi1QyMjpzKFCexSAV3vUUrbuGcnd1tDQ
        5qig2aJfA5VOsrp6wJFT/81F9FrXExfbPUxIS0+zaTBNZH0f7K8/+Og3aZfP3mu9/K1f
        Dxig==

X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
       d=1e100.net; s=20130820;
       h=x-gm-message-state:from:date:subject:to:message-id:mime-version;
       bh=MVJscsuoe7AdH+iVT/lVQ0uZgnjibw28JNl85/38V9w=;
       b=dn7BapgHe/NxRb42h3PfKpVnoDczDpC01gmBFJkK59hBgLpMPULPnM1chIf01qBCcA
        GNNdLLrGQ0u1pcY6qas96wdMq4tn6Dn/CdZBRF2U2A8JMNHaWOUIWTjKeb0aLDvYEGAj
        X31EHfO5HhhsDPjIBIdGTXp//vFv5ENZRBB1+jMl8Kg/N0SD0Vmg+z3cc4WdKKMHLJ8K
        6QTPgas+JB0/HBTgJMY9mxioA1DP66S4SY6BRUdoHOLfi2DwAW+sYL1LTX7Mn7SswCLS
        XTP3+dRhiWH/TDMk5LAGdrzslaJs5PPsoXTDLcxhuF65o7Rxxu3nF5An2xI9glYy9i0L
        vNPA==

X-Gm-Message-State: AD7BkJI+kiQHCcBtbXdGxMzDoKKXfTCmTJ65G1mxhFgo5j3wnapn/q4ZBH2CW9hST+wdvA==

X-Received: by 10.194.2.169 with SMTP id 9mr11099184wjv.7.1457419470686;
       Mon, 07 Mar 2016 22:44:30 -0800 (PST)

Received: from pc157.home (AMontsouris-559-1-38-238.w90-46.abo.wanadoo.fr. [90.46.189.238])
       by smtp.gmail.com with ESMTPSA id za6sm1296650wjc.18.2016.03.07.22.44.06
       (version=TLS1 cipher=ECDHE-RSA-AES128-SHA bits=128/128);
       Mon, 07 Mar 2016 22:44:26 -0800 (PST)

From: =?utf-8?Q?G=C3=A9rard_Filoche?= <gerard.filoche@gmail.com>

Content-Type: multipart/alternative; boundary="Apple-Mail=_506289E1-D636-4A3A-ABB5-54D4B18632DF"

Date: Tue, 8 Mar 2016 07:44:03 +0100

Subject: interv

To: Bernard 42 PS D&S motto-ros <bernardmottoros@gmail.com>

Message-Id: <D6BFDA45-133E-4F57-97B5-68C9633BCF72@gmail.com>

Mime-Version: 1.0 (Mac OS X Mail 9.0 \(3094\))

X-Mailer: Apple Mail (2.3094)

 

 

Myriam, j’ai noté que tu tenais à ce que cette loi porte ton nom.  Je te trouve courageuse.

Personne n’avait demandé cette loi. Aucun syndicat, aucune force sociale n’était demandeuse. Personne n’en avait exprimé le besoin, puisque que chacun sait que cela n’a pas de rapport avec l’emploi. Sauf Pierre Gattaz pour le Medef, qui a déclaré en août 2015 « le code du travail est l’ennemi n°1 des patrons ». Juste avant que ce projet de loi ne soit mis en route. Pourquoi donc ? Ce n’est pas clair. L’OCDE l’explique, il n’a été prouvé nulle part que la modification des codes du travail avait des effets positifs sur l’emploi. Le président a dit dans l’avion qui l’emmenait vers le Pacifique, le 21 février, que ce n’était pas tant pour l’emploi, que « pour un nouveau modèle social ». C’est un des intertitres de la loi. Quel modèle social ? Notre parti socialiste n’a jamais parlé de cela. ON n’a jamais discuté ici d’un « modèle social « nouveau à propos du changement du code du travail. D’où ça vient ? qu’est-ce que c’est ? Notre parti a toujours défendu le code du travail contre la droite. Nous avons célébré le code du travail menacé lors de son centenaire en 2010, affirmant combien il était précieux pour les travailleurs. Notre parti avait, dans son « Projet » 2011, promis de « reconstruire le code du travail », pas de l’affaiblir. Notre parti avait vigoureusement combattu la « recodification » faite par la droite de 2004 à 2008 par ordonnance.

Car dans ce pays il y a une mémoire de poisson rouge quand il est question du code du travail, mais il a été totalement réécrit, allégé, simplifié de décembre 2004 au 1er mai 2008 sous la direction du même JD Combrexelle qui officie à nouveau aujourd’hui. Il lui a été enlevé 10 % de ses signes, 1,5 million de signes. Un livre sur neuf, 500 lois ont été retirées sur 1150, mais les lois restantes ont été re-divisées et renumérotées en 3850 lois. C’était le moment ou Villepin imposait le CNE, cassé plus tard par l’OIT.  Puis le CPE cassé par la mobilisation de la jeunesse et les syndicats. Il s’agissait déjà de licencier plus facilement, plus longtemps et sans motif. Larcher était en faveur de ça. Il avait déclaré : « il y en a assez que les ayatollah de la Cour des cassation donnent des interprétations salafistes des temps forts du code du travail ». Laurence Parisot avait dit : « la liberté de penser s’arrête là ou commence le code du travail ». Et « La vie, l’amour, la santé sont précaires ; pourquoi le travail ne le serait-il pas ? » Chirac avait promulgué le nouveau code en pleine campagne présidentielle en mars 2007, sans que personne ne s’indigne, sauf les syndicats. La droite avait crié victoire. Le Sénat avait ratifié les 994 pages format A4 le 23 septembre 2007 en 20’. L’Assemblée nationale l’avait ratifié en 8 h, malgré notre forte résistance, nos amendements et notre refus, le 4 décembre 2008. En mai 2008 la droite avait crié victoire, affirmé que le code était simplifié, diminué, réécrit lisiblement. Donc la preuve du pudding, c’est qu’on l’a déjà mangé, mais depuis 2008 cela n’a donné aucun emploi, cela n’a servi à rien sinon à complexifier le droit dans les entreprises en faveur des patrons, pas des salariés. « Il faudra des mois, voire des années pour que le nouveau code révèle tous ses secrets » et « cela sera un effort colossal pour les usagers », avait expliqué le préfacier du nouveau code. Voilà qu’on veut à nouveau nous faire manger le même pudding, avec le même Combrexelle, pourquoi ?

Il n’y a pas eu concertation. Même Laurent Berger affirme  que c’est la première fois depuis trois ans qu’on lui présente un texte tout écrit avant d’en discuter avec lui. Pourtant la loi affirme qu’il doit y avoir concertation avant que pareil projet vienne au Parlement. Qu’est ce qui justifie cet empressement, ce viol de la loi, dans la façon d’imposer pareil bouleversement dans le code du travail ?

Car il s’agit d’une casse d’un siècle de code du travail depuis 1906 et 1910. La catastrophe de Courrieres a marqué notre histoire sociale avec la mort de 1099 mineurs. Le patron avait imposé de reprendre le travail avant qu’on n’ait retrouve tous les survivants. Treize jours après, 14 survivants étaient pourtant réapparus. L’indignation avait été telle qu’il avait été décidé de créer le ministère du Travail afin qu’il échappe aux exigences du ministère du Commerce et de l’Industrie. Et puis de faire un code du travail pour assurer la protection des salariés contre les exigences des entreprises, de la rentabilité. Le code du travail a été érigé pour défendre les droits, la vie des salariés contre les contraintes économiques. Il s’agissait de défendre les humains au travail, non pas de les soumettre aux exigences des entreprises. Rendre le travail humain ou rendre les humains soumis au travail : c’est un choix depuis cent ans. Et le président Hollande inverse ce choix, opère une contre-révolution conceptuelle quand il déclare contre ce siècle d‘histoire : « on va adapter le droit du travail aux besoins des entreprises ». Tout ce qui mérite le retrait de ton projet de loi, Myriam, est dans l’article 1 du préambule libéral de Badinter : celui qui dit que « les droits et libertés fondamentales sont soumis » au « bon fonctionnement des entreprises. »  Tout ce qu’il ne faut pas est concentré là. C’est une rupture théorique, historique, juridique, et pratique avec un siècle de notre histoire sociale, de tous nos combats socialistes.

Mais aussi avec le droit international. Car le droit du travail est un des droits de l’homme, de la femme au travail. Il relève de la Déclaration universelle des Droits de l’homme de 1948, de la Charte fondamentale des droits humains en Europe de 1999, des conventions de l’OIT, n° 81 ou 158 par exemple. D’ailleurs si nous sommes affiliés à l’OIT, Organisation Internationale du Travail, c’est parce que nous tendons à ériger un droit universel des travailleurs, c’est parce qu’il s’agit d’un droit fondamental, planétaire, et non pas d’un droit qui se négocie boutique par boutique, dérogation par dérogation, exception par exception, sous la houlette du patron local. Quelle erreur de vouloir faire un droit contractuel, aléatoire, entreprise par entreprise, au détriment des droits humains !

Cette usine à gaz est étrange : un ordre public qui n’est plus un ordre public, qui n’est plus chiffré, mais éthéré, qui met sur le même plan contrat civil, contrat commercial, et contrat de travail, la « personne » et le « salarié », le salarié » et l’indépendant « uberisé ». Ensuite tout devient négociable, même des droits sacrés dans la vie intime comme les congés en cas de décès. Puis restent des lois supplétives, de second rang, au cas où la négociation aurait été insuffisante ou maladroite de la part de l’employeur. Comme l’inversion de la hiérarchie des normes est renversée, le principe de faveur est mort. Tout est fait pour que le rapport de force entreprise par entreprise l’emporte sur les branches, sur le national, sur la loi ; c’est l’organisation d’un dumping social entre chaque entreprise, au moins disant social.

Et là, tout y passe. J’ai fait une étude critique de chaque article, J’avais demandé à ce que cela soit distribué aux membres du Bn par J.-C. Cambadelis, mais apparemment il ne l’a pas fait. Cela serait pourtant très utile d’entrer dans les détails car le diable est là.

Savez-vous qu’il sera possible à un patron de décider du premier jour où commence la semaine : vous, ici, vous croyez naïvement que la semaine commence le lundi. Eh bien non, l’arbitraire de cette loi est tel qu’elle permet au patron d’imposer un accord où la semaine commence par exemple le mercredi. Pourquoi ? le BHV à Paris a soumis aux syndicats de faire commencer la semaine le mercredi ; comme ça le dimanche est le 5° jour et il n’a pas à être majoré, et le repos compensateur n’a pas à être payé, la loi ne le dit pas. Il n’y a pas de limite à la recherche de profits et de dividendes, et la nouvelle usine à gaz, la loi El Khomri, permet de lever ces limites, comme avant 1906.

Et il sera possible par referendum de casser, diviser, affaiblir la majorité syndicale des salariés. Comme à Smart, dans la prospère usine de Daimler, à Hambach, en Moselle, le patron impose un referendum illégal pour faire travailler 39 h payées 37, au lieu de 35. Ce qui menace le Smic. D’ailleurs, j’aimerais avoir l’avis de la ministre sur ce coup de force.  56 % des personnels avec les cadres cèdent à ce chantage violent, mais 62 % des ouvriers refusent, les syndicats majoritaires, là-bas CGT et CFDT s’y opposent. Alors les patrons font signer, sous un chantage terroriste à l’emploi, à 90 % des salariés un contrat individuel qui impose leur coup de force. Qu’en dis-tu ? Parce que les syndicats majoritaires sont élus avec un quorum ! Il y faut une majorité de voix. C’est du solide. Et la loi que tu défends donnerait le pouvoir à des syndicats minoritaires à 30 % de demander la complicité du patron pour faire un referendum qui remettrait en cause la majorité des syndicats. Un referendum sous chantage sous pression et sans quorum.

Tu dis que cette loi lutte contre la précarité, les CDD des jeunes ? Mais où ? Où ?

L’ANI du 11 janvier 2013 et la loi Sapin du 14 juin 2013 prétendaient déjà lutter contre les CDD en les taxant, exceptionnellement et modérément, seulement de 0,5%, 1,5% et 3 %. j’avais déjà dit que cela échouerait, qu’il fallait soit des majorations draconiennes à 25 % soit des quotas… car on pourrait faire des quotas commecela a été fait pour les stagesdans laloi Chaynesse Khirouni. Il faut dire qu’il y avait 600 000 stages en 2008, et il y en 1,6 million aujourd’hui. Ce qui prouve qu’il y a du boulot pour les jeunes, mais les patrons ne veulent pas le payer. La loi Khirouni a mis un quota de 5 ou de 10 %, le décret d’application malheureusement l’a fixé à 15 %, mais il existe un quota. Pourquoi n’y a-t-il pas un quota maximum de précaires par entreprise, 5 % maximum pour remplacement de salariés absents, ou surcroît exceptionnel de travail. Au lieu de cela, tu le sais, le nombre de CDD a été… augmenté ; la loi Macron du 7 août 2015 a même contredit la loi Sapin et permis 3 Cdd de suite au lieu de deux. 3 Cdd… 18 mois, 545 jours qui, comme le CPE, précarisent surtout les jeunes (www.stop3cdd.fr). Tu dis que 85 % des jeunes sont embauchés en Cdd :  oui, mais en flux, mais pas en stock. C’est politique pas économique, c’est du bizutage ;  l’économie en fait ne peut pas fonctionner en CDD, 85 % des contrats réels sont des CDI et même 95 % entre 29 ans et 54 ans. Le CDI est la norme et s’allonge d’ailleurs de 9,5 ans à 11,5 ans en moyenne. Si on le veut, on peut stopper la précarité artificielle qui est organisée de façon délibérée.

Un barème est voulu pour limiter la réparation des préjudices subis par les salariés lors de licenciements ? Etrange : il a été instauré dans ce pays un « plancher » sécuritaire, pour que les juges ne puissent pas être indulgents avec les délinquants ordinaires, des peines plancher ! Et voilà que vous voulez mettre des peines plafonds pour les délinquants patronaux ! Quelle inégalité !  Où y a-t-il « équilibre » dans ce projet de loi ? Il est à 300 % pro patronal ; d’ailleurs, seul le Medef s’en réjouit.

Et faire travailler les apprentis 40 h et 10 h par jour, d’où ça vient, ça ? Déjà, nous devrions supprimer ce que Villepin a imposé : le travail des apprentis à 14 ans, et même, à 15 ans, le dimanche et de nuit. De plus, « nous » avons commis en 2015 un décret qui fait reculer la protection des enfants et leur permet de monter sur des escabeaux, des marchepieds et des échelles au risque de leur vie. On a même supprimé l’autorisation préalable de l’Inspection du travail avant de les laisser utiliser des machines dangereuses ; oui, chez nous, en France, c’est le gouvernement, sur la demande du Medef, qui a permis cela !

En fait il faut faire tout le contraire de la démarche de cette loi : il faut réglementer davantage ! C’est le droit DU travail qui fait du droit AU travail. Plus on déréglemente, plus on rentre dans les pays pauvres peu productifs ; pour être compétitifs, il faut des salariés bien formés, bien traités, bien payés, pas des flexibles, ni des précaires.

En fait, toutes les mesures de cette loi n’auraient aucun effet positif sur l’emploi.

S’il y a du travail pour 12 h par jour et 60 h par semaine, pourquoi y a-t-il des chômeurs ?

On a 1,3 million de chômeurs de plus depuis 4 ans qu’on facilite les licenciements. A quoi ça sert de faciliter les licenciements ? … A faciliter les licenciements !

 

 

Le Club est l'espace de libre expression des abonnés de Mediapart. Ses contenus n'engagent pas la rédaction.